PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g04790
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family ARF
Protein Properties Length: 664aa    MW: 73600.4 Da    PI: 6.185
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g04790genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B368.87.6e-22124225199
                EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                f+k+lt sd++++g +++ +++a+++       +++    ++l+ +d+++++W +++i+r++++r++lt+GW+ Fv++++L +gD ++F   + +++el+
  Tp2g04790 124 FCKTLTASDTSTHGGFSVLRRHADDClppldmsQQP--PWQELVATDLHNNEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFL--RGENEELR 219
                99****************************964333..4459************************************************..3488889* PP

                EEEE-S CS
         B3  94 vkvfrk 99 
                v+v+r+
  Tp2g04790 220 VGVRRH 225
                ***996 PP

2Auxin_resp114.88e-38250332183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 aaha++t+++F+v+Y+Pr+s+seF+v+v+k+++a ++k+svGmRfkm+fe+e+++e+r+sGt+vgv++ +++ W++S+WrsLk
   Tp2g04790 250 AAHAITTGTIFSVFYKPRTSRSEFIVSVNKYLEAKNQKLSVGMRFKMRFEGEEAPEKRFSGTIVGVQENKSSVWHDSEWRSLK 332
                 79*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.86E-44113253IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.9E-40121239IPR015300DNA-binding pseudobarrel domain
CDDcd100171.87E-19122224No hitNo description
PfamPF023621.1E-19124225IPR003340B3 DNA binding domain
SMARTSM010194.9E-21124226IPR003340B3 DNA binding domain
PROSITE profilePS5086310.588124226IPR003340B3 DNA binding domain
PfamPF065073.5E-35250332IPR010525Auxin response factor
PfamPF023091.5E-11533631IPR033389AUX/IAA domain
PROSITE profilePS5174530.122541634IPR000270PB1 domain
SuperFamilySSF542771.7E-11543618No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 664 aa     Download sequence    Send to blast
MAASNHPSGK PGGALSDALC RELWHACAGP LVTLPREGER VYYFPEGHME QLEASMHQGL  60
EQQMPSFNLP SKILCKVINI QRRAEPETDE VYAQITLLPE ADQSEPICPD APVQEPEKCT  120
VHSFCKTLTA SDTSTHGGFS VLRRHADDCL PPLDMSQQPP WQELVATDLH NNEWHFRHIF  180
RGQPRRHLLT TGWSVFVSSK KLVAGDAFIF LRGENEELRV GVRRHMRQQT NIPSSVISSH  240
SMHIGVLATA AHAITTGTIF SVFYKPRTSR SEFIVSVNKY LEAKNQKLSV GMRFKMRFEG  300
EEAPEKRFSG TIVGVQENKS SVWHDSEWRS LKVQWDEPSS VFRPERVSPW ELEPLVANST  360
PSSHPPPQRN KRPRPPGLPS PTTAPSTPVT ADGVWKSPAD NPSSVPLFSP PAKTAAYSHG  420
GNKSFGVSIG SAFWPTHADS AAESFASAFN ETPTEKKQTN GNVCRLFGFE LVENVNVDEC  480
FSAASVSGAV AVDQPVPSNE FDSSQQSVPL NTNQSNIPSG SGDPEKSSLR SPQESQSRQI  540
RSCTKVHMQG SAVGRAVDLT RSECYEDLFK KLEEMFDIEG ELLESTRKWQ VVYTDDEDDM  600
MMVGDDPWNE FCGMVRKIFI YTPEEVKKLS PKNKLTVNVR MQPKTDADEN GNTEGRSSST  660
AGSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.013591359Auxin response factor 1
4ldw_A0.013591359Auxin response factor 1
4ldw_B0.013591359Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1370374KRPRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00097PBMTransfer from AT1G59750Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794580.0JN979458.1 Brassica rapa subsp. pekinensis auxin response factor 1 (ARF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013672533.10.0PREDICTED: auxin response factor 1 isoform X3
RefseqXP_013672532.10.0PREDICTED: auxin response factor 1 isoform X3
RefseqXP_013672531.10.0PREDICTED: auxin response factor 1 isoform X3
RefseqXP_009103136.10.0PREDICTED: auxin response factor 1 isoform X1
RefseqXP_009103129.10.0PREDICTED: auxin response factor 1 isoform X1
RefseqXP_009103121.10.0PREDICTED: auxin response factor 1 isoform X1
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLH9B4B90.0H9B4B9_BRARP; Auxin response factor
STRINGBra035427.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88252227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.40.0auxin response factor 1